# medicube
324.07K
7.05B
Top 50 Hot Videos(medicube)
#ad Oil pulling is not fake if you double cleanse properly with the right duo.and the zero pore double cleansing duo does the work . See the way it got rid of my black heads and sebaceous filaments in 5mins I’m impressed @medicube global #medicube #zeroporecleansingoil #zeroporeblackheadmudmask #blackhead #porecleansing #doublecleansing #doublecleansingroutine
I can’t get over this skincare routine @medicube global #medicubepartner 🪄🪄🩷 🩷✨✨✨✨ #medicube #medicubedevice #boosterpro #glassskin #gelmask #amazonfavorites #sephora #ulta
Maybe No more Salmon sperm 😂? Have you tried PDRN products? Salmon Sperm? Cream & device from: @medicube global #medicube #pdrncapsulecream #boosterpro #miniboosterpro #glowbooster #medicubeskincare #medicubedevice #sephora #ulta #medicubepartner
Pore wash day with @medicube global 💗#medicube #zeroporecleansingoil #zeroporeblackheadmudmask #blackhead #porecleansing
#ad And it’s pink!! 💗💗 TT: @Medicube Global IG: @medicube_global_official #medicube #medicubeskincare #medicubedevice #miniboosterpro #sephora #ulta
#ad PDRN (Salmon DNA) injections- do they really work, and how can YOU get PDRN treatments in the US? Check out Medicube’s PDRN Pink Collagen Capsule Cream and their PDRN Pink Collagen Gel Mask! They also have a vegan version- Rose PDRN. #medicube #PDRNCapsuleCream #SalmonDna #pdrncollagenmask #collagenmask #pdrnserum #medicubeskincare #sephora #ulta @Medicube Global #medicubepartner
#ad my skin is glass 😧 the new skincare combo I’ve been loving using the medicube wrapping mask, booster pro, & pdrn peptide serum ✨ #medicube #medicubeskincare #medicubedevice #boosterpro #pdrnpeptideserum #sephora #ulta #amazon
#ad I love this face mask!! 🤍 TT: @medicube global IG: @medicube_global_official #medicube #medicubeskincare #pdrncollagenmask #sephora #ulta #amazon
Is the @medicube global booster pro Jeffree Star Approved?! #medicube #jeffreestar #boosterpro #kyliejenner #kyliejennerdevice #medicubedevice #medicubeskincare #skincarereview #beautytips
Skin’s never been happier 🫶🏼 Literally obsessed with this @medicube global trio: PDRN Pink Collagen Capsule Cream, my fav Booster Pro, and the PDRN Pink Caffeine Wrapping Mask to depuff overnight #medicubepartner #medicube #boosterpro #kyliejennerdevice #medicubedevice #medicubeskincare #glassskin #pdrnwrappingmask #depuffing #ulta #Skincare
#ad Kylie Jenner is revealing all her secrets! is THIS the one for flawless skin? @medicube global #medicube #medicubedevice #kyliedevice #ulta #foryou #fyp
✨Glass skin sí existe… y quise probar el combo favorito de Kylie con @medicube y es el Modo booster + suero rosa + cápsulas TXA = piel más suave, luminosa e hidratada 💖 #amazon #amazonfavorites #amazonmusthaves #amazonprimeday #medicube #medicubeskincare #medicubedevice #boosterpro #pdrnpinkpeptideserumb
Not gonna lie, my underarms have been through it 😩 Dark spots, hyperpigmentation I’ve tried a lot. But This Medicube Red Acne Body Peeling Shot is one of the few things that’s actually helping to smooth out and get rid of my hyperpigmentation and dark under arms If you’ve been dealing with dark underarms (or chicken skin too),and you need an 100 percent effective product to achieve a better result for your dark under arm , you definitely need this in your routine @medicube global #medicube #redbodypeelingshot #bodycare #medicubeskincare #bodypeeling #exfoliate #chickenskin #underarmcare #ulta #darkunderarms #darkarmpits #hyperpigmentation #underarmskincare
vous avez vu?👀🏃🏽♀️☀️ Products : - @Poppy Cloudy 🤍 chin strap - @Wonderskin Beauty lip stain - @medicube global collagen sheet mask - @Amazon Beauty heatless curls set - @Caudalie vinoperfect mousse - @WHIPPED lemon cream cleanser - #medicube toner pads - @SEPHORA strawberry lip mask - @Color Wow Hair hair frizz - @Dyson France - @Kosas vegan spray - @laneige_us mango lip balm - #tsururi nose black heads - @BenefitFrance brow gel - @SKIN1004 US centella toner - @rhode skin glazing milk - #medicube peptides serum - @Lancôme triple renergie serum - @Kiehl's Since 1851 #kiehlsfrance avocado eye treatment - #rhode glazing fluid - #medicube vita c cream capsule - @AXIS-Y #axisy sunscreen - #caudalie eau de vigne - @Diorbeauty foundation stick - #rhode glazing milk - @dr.althea_official concealer - @NYX COSMETICS FRANCE Buttermelt bronzer - @Saie drops - @Rare Beauty blush - @YSL Beauty setting powder - @Charlotte Tilbury rock chic palette - #yslbeauty liquid blush - #hourglasscosmetics @Hourglass Cosmetics palette - @Fenty Beauty highlighter - @Maybelline France setting spray - #charlottetilbury finishing powder - #nyxprofessionalmakeup fat oil & lip IV - #ysl plumper - @pradabeauty paradoxe #grwm #grwmroutine #getreadywithme #grwmaesthetic #grwmskincare #skincare #haircare #makeup #bodycare #secretbeaute
Glow by day, repair by night. Vitamin C capsules to brighten the drama, PDRN pink pearls to rebuild the stage. Your skin? Front row. Your glow? Unapologetic! #medicube #vitaccapsulescream #pdrnpinkcollagencapsulecream #glowingskinjourney #koreanskincare #skincare @medicube global
Part 26 | This collagen jelly cream from @medicube global is your one step to glass skin, it tightens enlarged pores too!! Tested and trusted, shop now on Amazon to get some % off✨ . . . #amazon #amazonfavorites #amazonmusthaves #amazonprimeday #medicube #medicubeskincare #medicubedevice #koreanskincare #ceeforcynthia #fyp
#partner I tried this skincare routine once and haven’t looked back since #medicube #glassskin #koreanskincare #realskinresults #pdrn #boosterpro #ulta #amazon #amazonfavorites #amazonmusthaves #amazonprimeday #medicubeskincare #medicubedevice @medicube global
I was invited to Creator Picks L.A. and stopped by the @medicube US Store and @APRILSKIN USA booth! How fun was this activity for the content creators?! 😍 I had 40 seconds to scoop out product 😅 #contentcreator #contentcreation #medicube #aprilskin #yoofinds #fastmoss #creatorpicksla
#ad No more pain ever again thanks to @medicube global #medicube #pdrn #skincare #gelmask #boosterpro #rejuran #ad
#ad ✨ “If you’re battling dark spots, uneven skin tone, or dullness — THIS is your glow-up in a jar! 🌞💛 The Medicube Vita C bundle has my skin looking brighter, clearer, and SO much healthier. #Medicube #VitaC #GlassSkin #DarkSpotCorrector #BrighteningSkincare #KBeautyFinds #TikTokShopCreatorPicks #IfYouKnowYouKnow #TTSLevelUp #Kickstart #CreatorIcons #TTSThunderbolt #TikTokShopSummerTurnup #FunInTheSun #SuperBrandClub @medicube US Store @MEDICUBE USA
#ad Salmon sperm eyedrops recommended by my mom! @medicube #medicube #pdrn #salmonpdrn #salmondna #skincare #kbeauty #antiaging #hyperpigmentation #koreanskincare #skincareroutine #skincaretips @medicube global @medicube_us
Why I love hypochlorus acid? - it’s as strong as bleach for killing bacteria — but as gentle as water on your skin. 🧪✨ It calms breakouts, soothes irritation, and protects your barrier #medicube #hypochlorousacidspray #boosterpro #pdrnpeptideserum #antibacterial #acne #breakout #redness #medicubeskincare #medicubedevice @medicube global
GLOW U GLOU Products : - @Poppy Cloudy 🤍 chin strap - @Wonderskin Beauty lip stain - @medicube global vita c collagen sheet mask - @SKIN1004 US oil cleanser - @Caudalie mousse - @WHIPPED #whippedcleanser #whipped cream cleanser lemon - @APRILSKIN USA clay mask - @dr.althea_official #dralthea powder clay mask - @Tatcha US lip mask - #medicube toner pads - @Biotherm body cream - #caudalie eau de vigne - #tsururi black heads remover - @The Ordinary lashes and brows serum - #medicube age pro booster mini - #kerastase oil - @VT Cosmetics US pdrn ginseng - #tatcha dewy mist - #Skin1004 centella toner - #tatcha camélia essence - #medicube peptides serum - @L’Oréal Paris revitalift serum - @Kiehl's Since 1851 #kiehlsfrance midnight serum - #tatcha dewy serum - @AXIS-Y #axisy eye cream - #vtcosmetics pdrn essence - @Erborian France yuzu anti taches cream - @rhode skin butter barrier #grwm #grwmroutine #getreadywithme #grwmaesthetic #grwmskincare #skincare #haircare #makeup #bodycare #secretbeaute
#ad HUBBA BUBBA LITERALLY ON MY FACE LOL #bubblegumcleanser #medicube #kbeauty #koreanskincare
not a pretty day Products : - @Poppy Cloudy 🤍 chin strap - @Wonderskin Beauty lip stain - @medicube global collagen vita c sheet mask - @Biotherm cleanser - @La Roche-Posay peeling - #medicube toner pads - @Dyson France airwrap - #shuuemura styling cream - @Tatcha US dewy mist - @VT Cosmetics US pdrn reedle shot 100 & ginseng - @Glow Recipe watermelon toner - @The Ordinary milky toner - @Kiehl's Since 1851 #kiehlsfrance serum - #tatcha Dewy serum - @Erborian France yuzu serum - @AXIS-Y #axisy eye cream - #vtcosmetics pdrn essence balm - #larocheposay Cicaplast B5 - @rhode skin butter barrier - @dr.althea_official sunscreen - @chanel.beauty fluid - @NYX COSMETICS FRANCE glue primer - @Sol de Janeiro mist & bum bum body cream - #dralthea concealer palette - @tarte cosmetics concealer - #nyxprofessionalmakeup Buttermelt bronzer - @Huda Beauty setting powder - @KIKO Milano eyeshadow palette - @BenefitFrance brown eyeliner - @SHISEIDO eyelash curler - #benefit brow gel - @Maybelline France mascara - @IT Cosmetics blush - @Diorbeauty palette - #rhode pocket blush - @YSL Beauty all hours hyper bronze - @Fenty Beauty diamond shell - #maybellinefrance setting spray - #nyx combo - @Kylie Cosmetics lip gloss - @Caudalie eau de vigne - #summerfridays face spray #grwm #grwmroutine #getreadywithme #grwmaesthetic #grwmskincare #skincare #haircare #makeup #bodycare #secretbeaute
#ad 🫧🧴Medicube’s glow in a week set! 🪩For glass skin🙌🏼🤩All of their new and improved viral products in one big bundle! 📦✨#medicubeglowingskinessentials #medicube #medicube #medicubetiktokshop #medicubeglassskin #medicubebundle #medicubeskincare #medicubecapsulecream #capsulecream #medicubepdrngeltonerpad #hypochlorousacidspray #glassskinroutine #oilcleanser #medicubesupersale #koreanskincare #viralkoreanskincare #tiktokshopcreatorpicks #tiktokshopfinds #tiktokshopmademebuyit #dealsforyoudays #ttsbeautybesties #creatorpickssuncare #funinthesun #tiktokshopnewarrivals
#ad @medicube global this just might be your best set yet. ##medicube##medicubetonerpad##Skintok##Skinprep##makeuptips##makeuphacks##makeuptutorial##acnehacks##acneproneskin##tiktokshopcreatorpicks##tiktokshopspringglowup##fyp##makeuptok##beautytips##acnehacks##hyperpigmentation##finelines##medicubesupersale
#ad I <3 Korean skincare #medicube #koreanskincare #tonerpad #zeroporepad #medicubezeroporepad #exfoliatingtoner #tiktokshopmemorialday
#ad pdrn PINK CAFFEINE night wrapping mask?!? 💕🥹👏🏽🩷 @medicube_us @medicube global did it AGAIN!! #medicube #pdrnpinkcaffeinenightwrappingmask #pdrncollagenwrappingmask #pdrn #nightwrappingmask #caffeinefacemask #koreanskincare #glassskin #dealsforyoudays #tiktokshopcreatorpicks #SuperBrandClub #summertransformation #summerwonderland